Klas:
Docent: Laurie, Mans
Datum: 29 oktober 2021
Versie 1
MBO peptide letter: K
MBO plasmide nr.: 16
,Inhoudsopgave
I identificatie eiwit......................................................................................................................................... 3
II kloneringsstrategie..................................................................................................................................... 5
Primers.................................................................................................................................................................5
Restrictie-enzymen...............................................................................................................................................6
In frame................................................................................................................................................................6
III uitvoering klonering................................................................................................................................... 8
PCR programma:..................................................................................................................................................8
Restrictie protocol................................................................................................................................................8
Plasmide controle.................................................................................................................................................9
IV validatie eiwit fusie-eiwit......................................................................................................................... 10
Cellijn voor expressie..........................................................................................................................................10
Eiwitdetectie.......................................................................................................................................................10
Zuivering.............................................................................................................................................................10
V achtergrond informatie............................................................................................................................. 11
, I IDENTIFICATIE EIWIT
Uit de verkregen MS peptiden is er gepuzzeld en kwam er een sequentie uit:
PSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFL
Deze is geïdentificeerd met behulp van BLAST.
Hier kwam het eiwit Cyclin-dependent kinase 1 (CDK1) isoform 4 uit. (1)
Cyclin-dependent kinase 1 isoform 4 [Homo sapiens] sequence ID: NP_001163877.1
1 medytkieki gegtygvvyk grhkttgqvv amkkirlese eegvpstair eisllkelrh
61 pnivslqdvl mqdsrlylif eflsmdlkky ldsippgqym dsslvkvka
Van dit eiwit is hieruit ook de mRNA sequentie met CDS; Homo sapiens cyclin dependent
kinase 1 (CDK1), transcript variant 4, mRNA. (Bijlage 2) (2)
In het verkregen plasmide (figuur 2) zitten een aantal onderdelen in de sequentie zoals de
promoter, MCS, een antibiotica-resistentie, tag en een fluorescerend eiwit.
Figuur 2: Plasmide met bijbehorende kenmerken.
De promoter zit op de plek 319 – 912 en is een CMV promoter. De CMV promoter is er om
de genexpressie aan te sturen. (3)
De TAG zit op plek 924-1643 en is de GST variant. GST is een afkorting voor Glutathione-S-
transferase. De GST tag maakt eiwitzuivering voor zowel bekende als onbekende
eigenschappen mogelijk (4)
MCS staat voor multiple cloning site, dit wordt ook wel polylinker genoemd. Dit is een plek
in het plasmide waar meerdere unieke knipplaatsen voor restrictie-enzymen bevat. In de MCS
zitten de restrictie-enzymen MreI, PauI, HindIII, XbaI, EcoRI, SalI, XmiI, BamHI, Acc65I en
KpnI op de plek 1644 – 1696.
De fluorescente marker, tdTomato, zit op de plek 1697 - 3127. tdTomato is een helder rood
fluorescent eiwit met een emissiegolflengte van 581nm. Dit is ook de golflengte waaronder
het bekeken moet worden. (5)
The benefits of buying summaries with Stuvia:
Guaranteed quality through customer reviews
Stuvia customers have reviewed more than 700,000 summaries. This how you know that you are buying the best documents.
Quick and easy check-out
You can quickly pay through credit card or Stuvia-credit for the summaries. There is no membership needed.
Focus on what matters
Your fellow students write the study notes themselves, which is why the documents are always reliable and up-to-date. This ensures you quickly get to the core!
Frequently asked questions
What do I get when I buy this document?
You get a PDF, available immediately after your purchase. The purchased document is accessible anytime, anywhere and indefinitely through your profile.
Satisfaction guarantee: how does it work?
Our satisfaction guarantee ensures that you always find a study document that suits you well. You fill out a form, and our customer service team takes care of the rest.
Who am I buying these notes from?
Stuvia is a marketplace, so you are not buying this document from us, but from seller ryannevanderwerf. Stuvia facilitates payment to the seller.
Will I be stuck with a subscription?
No, you only buy these notes for $6.42. You're not tied to anything after your purchase.