BCH403 FINAL EXAM QUESTIONS WITH REVISED ANSWERS – UPDATED!!
7 views 0 purchase
Course
BCH403
Institution
BCH403
BCH403 FINAL EXAM QUESTIONS WITH REVISED ANSWERS – UPDATED!!
Which of the following is NOT a potential function of specific transcription factors? - Answer-Melt promoter DNA
The following peptide is dissolved in a solution of pH 7. M-D-L-P-S-K. What is the peptide's net charge and can this pe...
BCH403 FINAL EXAM QUESTIONS
WITH REVISED ANSWERS –
UPDATED!!
Which of the following is NOT a potential function of specific transcription factors? -
Answer-Melt promoter DNA
The following peptide is dissolved in a solution of pH 7. M-D-L-P-S-K. What is the
peptide's net charge and can this peptide be purified by ion exchange chromatography?
- Answer-0, and it cannot because it is at the isoelectric point.
The process by which hydrophobic molecules are driven together, therefore maximizing
the entropy of water, is referred to as the hydrophobic effect - Answer-True
Which of the following pairs of amino acids are polar, but uncharged at neutral pH: -
Answer-N, Q
Which of the following is NOT TRUE regarding a biochemical reaction? - Answer-A
largely negative delta G means that eventually, the reactants will run out completely.
Which of the following is NOT part of the peptide bond plane? - Answer-R-group of the
second residue
Secondary structures are stabilized by which of the following? - Answer-Hydrogen-
bonding between a carbonyl oxygen and an amide hydrogen
In Myoglobin, the bound oxygen occupies the sixth ligand for iron, meaning that no
more than one molecule of oxygen can bind per molecule of protein - Answer-True
Interior packing of hydrophobic residues contributes favorably to both delta S and delta
H because of the hydrophobic effect and the many hydrogen-bonding interactions
between nonpolar side chains - Answer-False
The following amino acid sequence belongs to a fibrous protein.
GAAGPPGPAGPAGERGEQGAPGPSGFQGLPGPP. Which of the following is the best
match? - Answer-Tropocollagen
The following is the secondary structure of a polypeptide. The cylinders represent
amphipathic alpha helices. Which of the following primary sequences would most
closely match the structure? - Answer-
GMADRLLNEPRISSAIVASAAQWVSTIVKFAMKISAVIPR
, Affinity chromatography: - Answer-separates proteins based on attraction to another
molecule
Covalent cross-linking of lysine side chains is a feature that helps stabilize: - Answer-
Tropocollagen
Peptide bonds behave as rigid planes because of the partial double-bond character
between the carbonyl carbon of one residue and the amide hydrogen of another residue
- Answer-False
The diagonal contacts between the alpha-1 and the beta-2 subunits of Hb are important
for cooperativity because of: - Answer-They are intermediate strength, so that they can
move, but a change in one causes a change in the other.
Which amino acid is most likely to stabilize extracellular proteins and why? - Answer-
cysteine because it forms covalent disulfide bonds
In Michaelis-Menten enzyme kinetics, when an enzyme becomes halfway saturated with
substrate, the reaction becomes zero order with respect to substrate - Answer-False
The strong electronegativity of carbon is responsible for the lack of hydrogen bonding
for molecules that contain hydrocarbons - Answer-False
You intend to determine the structure of a small protein that folds into multiple
conformations. Which of the following strategies is most appropriate? - Answer-Nuclear
Magnetic Resonance
The Henderson-Hasselbach equation is only able to calculate the fraction ionization of
an amino acid when the pH is equal to the pKa - Answer-False
The basis of cooperativity in hemoglobin requires that the heme plane becomes
flattened upon oxygen binding, which is followed by a change in the protein
conformation - Answer-True
A vitamin-C deficiency causes the disease known as Scurvy because the enzyme lysyl
oxidase becomes non-functional - Answer-False
The classic unfolding experiment using Ribonuclease A demonstrated that: - Answer-
The information needed to fold a protein is encoded in the primary amino acid
sequence.
The transient force which, while weak, still has a large impact on how protein molecules
fold is the - Answer-Van der Waals interaction
You've modified Myoglobin to make two mutants. Mutant X replaces the proximal
histidine with an alanine. Mutant Y replaces the distal histidine with an alanine. Which of
The benefits of buying summaries with Stuvia:
Guaranteed quality through customer reviews
Stuvia customers have reviewed more than 700,000 summaries. This how you know that you are buying the best documents.
Quick and easy check-out
You can quickly pay through credit card or Stuvia-credit for the summaries. There is no membership needed.
Focus on what matters
Your fellow students write the study notes themselves, which is why the documents are always reliable and up-to-date. This ensures you quickly get to the core!
Frequently asked questions
What do I get when I buy this document?
You get a PDF, available immediately after your purchase. The purchased document is accessible anytime, anywhere and indefinitely through your profile.
Satisfaction guarantee: how does it work?
Our satisfaction guarantee ensures that you always find a study document that suits you well. You fill out a form, and our customer service team takes care of the rest.
Who am I buying these notes from?
Stuvia is a marketplace, so you are not buying this document from us, but from seller Perfectscorer. Stuvia facilitates payment to the seller.
Will I be stuck with a subscription?
No, you only buy these notes for $13.29. You're not tied to anything after your purchase.
