MB ASCP EXAM PACK|GUARANTEED SUCCESS

Predominant form of DNA Right-handed B DNA and histone interaction is due to what type of bond? Ionic What stains to the minor groove of DNA duplex? SYBR Green What is the most abundant type of RNA? Ribosomal RNA (rRNA) What does RNA act as in a retrovirus? Genome an...

What is the function of DNA? Store genetic information Purine Double ring of nitrogen base (G, A) Pyrimidine Single ring of nitrogen base (T, C) What is the complementary sequence to 5'AGGTCA3' ? 5'TGACCT3' Which of the ribose carbons participate in the phosphodie...

What kind of bond do histones have with DNA? Ionic What amino acids compose histones? Lysine and Arginine Which lymphoma has t-cell rearrangements? Sezary Syndrome Acute Promyelocytic leukemia translocation? t(15,17) Leading strand polymerase: Delta DNA repair...

What is metagenome? Sampling the genome sequence of a community of organisms. Polymorphism involved for Irinotecan? UGT1A1 NGS related to deletions and insertions, coverage, depth? -Paired-end reads for detection of indels -Coverage is how much of your target has been read -Depth ...

Which of the following is not a component of a nucleotide? Phosphate group Anti-codon Ribose sugar Nitrogen base Anti-codon According to Chargaff's rule of base pairing, adenine pairs with: Thymine What genes would be screened in a breast cancer panel? HER2, ERBB2, BRCA1 ...

Acute Promylocity Leukemia (APL) t(15:17) PML / RARa genes Chronic Myelogenous Leukemia (CML) t(9:22) a.k.a. Philadelphia chromosome ABL1 / BCR genes 01:19 01:25 Burkitt's non-Hodkin's Lymphoma t(8:14) dysregulation of c-myc gene breakpoints on ch.8 spread over 190k...

ASCP Molecular Biology Exam Prep|2023 LATEST UPDATE|GUARANTEED SUCCESS

What does barcoding do in Next Generation Sequencing? Adds unique tag to all nucleic acids within one sample so that various samples can be mixed What is the best way to store RNA for longer than a month? In Ethanol, at -20°C or -80°C Testing for Aldehyde Dehydrogenase deficiency i...

The enzyme that primes DNA synthesis is: DNA primase Which of the following is a common hydrogen bond acceptor? a) A carbonyl b) Primary amine c) Hydroxyl d) Tertiary amine b) Primary amine What assay is a signal amplification test and uses Alkaline Phosphatase? a) Branched ...

What is translocation is associated with Burkitt's Lymphoma? a. t(18; 14) b. t(9; 22) c. t(8; 14) d. t(15; 17) t(8; 14) TIP: Burkkitt's 8 letters, Locus PF Child Paternity Index LOC-A1 3 2/3 2.18 LOC-B2 7/5 5 0.798 LOC-C3 17/17 9/17 5.21 LOC-D4 12 12 1.37 Based on the dat...

What are the 3 types of gel electrophoresis Agarose Polyacrylamide Pulse Field What is gel electrophoresis the separation of materials based on size and migration patterns when subjected to electrical forces in a resistive medium. which direction does the DNA flow in gel electropho...

What is significant about this protein: LGEKKWCLRVNPKGLDESKDYLSLKSKTLLL there is a leucine residue at sequential 7th positions forming a leucine zipper, found in transcription factors. A leucine zipper is a specialized secondary structure of protein.

1. Given the anti-sense strand of DNA: 5'-AATTGCCGACATAGAT-3' which is the appropriate sense strand? A. 5'-ATCTATGTCGGCAATT-3' B. 5'-TTAACGGCTGTATCTA-3' C. 5'-AATTGCCGACATAGAT-3' D. 5'-GAGCACGCTATCTTAT-3' A. 5'-ATCTATGTCGGCAATT-3' 2. Consider the probe sequence, CTACCGTAATATT...

The bond between a phosphate group and the ribose sugar group in RNA is called which of the following? (A) Phosphodiester linkage (B) Glycosidic bond (C) Peptide bond (D) Amide bond B. Glycosidic bond Which of the following is does not play a role in DNA replication? (A) DNA polymerase ...