100% satisfaction guarantee Immediately available after payment Both online and in PDF No strings attached
logo-home
Previously searched by you
Previously searched by you
logo
BCH403 FINAL EXAM QUESTIONS WITH REVISED ANSWERS – UPDATED!! $13.49
Add to cart
Quickly navigate to
Preview
  2.  
  3. BCH403
  4.  
  5. BCH403

Exam (elaborations)

BCH403 FINAL EXAM QUESTIONS WITH REVISED ANSWERS – UPDATED!!
 0 purchase
  • Course
  • BCH403
  • Institution
  • BCH403

BCH403 FINAL EXAM QUESTIONS WITH REVISED ANSWERS – UPDATED!! translation. - Answer-Release factors Argonaute: - Answer-Selects which strand of miRNA will be used to target mRNA When run on an agarose gel, DNA will migrate through the gel: - Answer-Naturally because DNA is already overwhel...

[Show more]

Preview 2 out of 13  pages

Document information

  • September 7, 2024
  • 13
  • 2024/2025
  • Exam (elaborations)
  • Questions & answers

Subjects

  • bch403
  • bch403 final exam questions
  • bch403 final exam questions with revised answers

Written for

  • BCH403
  • BCH403

Seller

avatar-seller
shiifridoc

Reviews received

Content preview

BCH403 FINAL EXAM QUESTIONS
WITH REVISED ANSWERS –
UPDATED!!
Stop codons are recognized by , which results in the termination of
translation. - Answer-Release factors

Argonaute: - Answer-Selects which strand of miRNA will be used to target mRNA

When run on an agarose gel, DNA will migrate through the gel: - Answer-Naturally
because DNA is already overwhelmingly negative

A technique commonly used to separate proteins based solely on length is called: -
Answer-SDS-Polyacrylamide gel electrophoresis (SDS-PAGE)

Alternative splicing: - Answer-requires the spliceosomes and additional components that
block splicing sites

When found in the Wobble position (5' of anticodon), guanine can form Wobble
interactions with: - Answer-U

The addition of the poly A tail: - Answer-Is coupled to transcription termination

Based on the codon table and the mRNA sequence below, which one of the following
point mutations represents a nonsense mutation? (Mutation is highlighted in orange).
Assume reading frame 1. - Answer-AUG AAU GAU CCG UAA GAU GAG

DNA directly transferred from one bacterium to another bacterium is called: - Answer-
Conjugation

Nuclear proteins: - Answer-Are translated by free ribosomes and transported into the
nucleus via the nuclear pore

Artificial restriction enzymes: - Answer-Uses DNA-binding proteins to guide an
endonuclease to the target DNA site

Which one of the following represents blunt cut DNA? (Note: ▼ represents site of cut
DNA) - Answer-CAT ▼ ATG

In eukaryotes, the aminoacyl-tRNA is loaded into the A-site of the ribosome by: -
Answer-eEF1α (alpha)

In prokaryotes, folded proteins are transported out of the cytoplasm via: - Answer-Twin
Arginine Transport (TAT) pathway

, The insertion of a gene into a genome is called: - Answer-Knock-in

Which of the following is NOT a potential function of specific transcription factors? -
Answer-Melt promoter DNA

The following peptide is dissolved in a solution of pH 7. M-D-L-P-S-K. What is the
peptide's net charge and can this peptide be purified by ion exchange chromatography?
- Answer-0, and it cannot because it is at the isoelectric point.

The process by which hydrophobic molecules are driven together, therefore maximizing
the entropy of water, is referred to as the hydrophobic effect - Answer-True

Which of the following pairs of amino acids are polar, but uncharged at neutral pH: -
Answer-N, Q

Which of the following is NOT TRUE regarding a biochemical reaction? - Answer-A
largely negative delta G means that eventually, the reactants will run out completely.

Which of the following is NOT part of the peptide bond plane? - Answer-R-group of the
second residue

Secondary structures are stabilized by which of the following? - Answer-Hydrogen-
bonding between a carbonyl oxygen and an amide hydrogen

In Myoglobin, the bound oxygen occupies the sixth ligand for iron, meaning that no
more than one molecule of oxygen can bind per molecule of protein - Answer-True

Interior packing of hydrophobic residues contributes favorably to both delta S and delta
H because of the hydrophobic effect and the many hydrogen-bonding interactions
between nonpolar side chains - Answer-False

The following amino acid sequence belongs to a fibrous protein.
GAAGPPGPAGPAGERGEQGAPGPSGFQGLPGPP. Which of the following is the best
match? - Answer-Tropocollagen

The following is the secondary structure of a polypeptide. The cylinders represent
amphipathic alpha helices. Which of the following primary sequences would most
closely match the structure? - Answer-
GMADRLLNEPRISSAIVASAAQWVSTIVKFAMKISAVIPR

The benefits of buying summaries with Stuvia:

Guaranteed quality through customer reviews

Guaranteed quality through customer reviews

Stuvia customers have reviewed more than 700,000 summaries. This how you know that you are buying the best documents.

Quick and easy check-out

Quick and easy check-out

You can quickly pay through credit card or Stuvia-credit for the summaries. There is no membership needed.

Focus on what matters

Focus on what matters

Your fellow students write the study notes themselves, which is why the documents are always reliable and up-to-date. This ensures you quickly get to the core!

Frequently asked questions

What do I get when I buy this document?

You get a PDF, available immediately after your purchase. The purchased document is accessible anytime, anywhere and indefinitely through your profile.

Satisfaction guarantee: how does it work?

Our satisfaction guarantee ensures that you always find a study document that suits you well. You fill out a form, and our customer service team takes care of the rest.

Who am I buying these notes from?

Stuvia is a marketplace, so you are not buying this document from us, but from seller shiifridoc. Stuvia facilitates payment to the seller.

Will I be stuck with a subscription?

No, you only buy these notes for $13.49. You're not tied to anything after your purchase.

Can Stuvia be trusted?

4.6 stars on Google & Trustpilot (+1000 reviews)

69052 documents were sold in the last 30 days

Founded in 2010, the go-to place to buy study notes for 15 years now

Start selling
$13.49
  • (0)
Add to cart
Added